PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.03G225200.1.p
Common NameGLYMA_03G225200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 419aa    MW: 46765.1 Da    PI: 7.003
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.03G225200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-171461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Glyma.03G225200.1.p 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                         678*******************************************97 PP

2Myb_DNA-binding46.67.8e-1567110146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rg +++eE+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Glyma.03G225200.1.p  67 RGTFSQEEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                          899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.926961IPR017930Myb domain
SuperFamilySSF466891.61E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002493.0E-151461IPR001005SANT/Myb domain
CDDcd001671.03E-111761No hitNo description
PROSITE profilePS5129425.94862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1366114IPR001005SANT/Myb domain
PfamPF002491.0E-1367111IPR001005SANT/Myb domain
CDDcd001671.74E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKPLS EVENGEEGKT RSQELSNELN LLNSESFKSD EGSYEQRASS IAPKAYEMEG  180
SCSSKINNTK NDTNLMSNCS NKDMFLDSYT TSCQPSDLMG NYPLHITDTL PTNSNSCHWF  240
SQTARPFDIN SNSEFTITSN VMSILPPTTT SFLPSTSFCY KPSLGVPSED ISAPSFGLNG  300
PSYWEASASN NSNGSNNTSD GSRELTTTSS KNSVLSSWEL TEEAKWSEYL HNPMLMLAAP  360
ESLCNQIRPA THLIPDNTLG AIILPDSKNQ QQQQQQQSQN SCIFSKDVQK LTAAFGHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAPTransfer from AT4G01680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311850.0KT031185.1 Glycine max clone HN_CCL_13 MYB/HD-like transcription factor (Glyma03g38410.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304642.10.0transcription factor MYB86-like
TrEMBLI1JQY10.0I1JQY1_SOYBN; Uncharacterized protein
STRINGGLYMA03G38410.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.36e-94myb domain protein 55